PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00472.1.g00110.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 585aa    MW: 62000.1 Da    PI: 7.1715
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00472.1.g00110.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.94.7e-18188234148
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                   +g+WT+eEd+ l + v+++G + W+ +ar+++ gR +kqc++rw ++l
  Zmw_sc00472.1.g00110.1.am.mk 188 KGPWTAEEDDVLREMVREHGDRKWAVVARYLP-GRIGKQCRERWTNHL 234
                                   79******************************.************996 PP

2Myb_DNA-binding52.88.9e-17242282345
                                   SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
               Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                                    WT+e+d+ l++a+k +G++ W+ Iar ++ gR+++++k++w+
  Zmw_sc00472.1.g00110.1.am.mk 242 LWTEEDDLALIEAHKVYGNR-WSMIARFLP-GRSENSVKNHWN 282
                                   5*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129426.646183238IPR017930Myb domain
SuperFamilySSF466891.35E-30187281IPR009057Homeodomain-like
SMARTSM007179.8E-18187236IPR001005SANT/Myb domain
PfamPF002497.3E-17188234IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-24189239IPR009057Homeodomain-like
CDDcd001671.42E-15190234No hitNo description
SMARTSM007171.3E-15239287IPR001005SANT/Myb domain
PROSITE profilePS5129420.986239289IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.2E-20240284IPR009057Homeodomain-like
PfamPF002495.0E-14242282IPR001005SANT/Myb domain
CDDcd001671.15E-13243282No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 585 aa     Download sequence    Send to blast
MVYVSQSDGC ATEGTSRAPG NEWGDSESRE VAWTRAVECE WWLTTWTAGA ARAPSIYCAR  60
RIDSALSHLQ AATALLLLAR LRSCPLGSTT GNDVSAAAAV HPGNVARAVP AAAGMLRPSM  120
GALLAGFGMA PSGMFLPGRP PAPSPAAVYG AGANAPRAVW NGGAVVAAEQ QPRAGSGHGE  180
RAPAPAQKGP WTAEEDDVLR EMVREHGDRK WAVVARYLPG RIGKQCRERW TNHLRPDIKK  240
SLWTEEDDLA LIEAHKVYGN RWSMIARFLP GRSENSVKNH WNATRRSLKA KRRLKKKRNA  300
AQPTSPPGVD HCSVLEEYIR GVYPAAATDP TAPSPSVSPP SYNLAYGDAV SPLPAATAGG  360
LFDPMAAAAA GMGIMMYHNP GASGISSSAS PPSSNAGTAA TDNVNNVPPP LMLDLNAYYG  420
EAPLHAMRKP PPPAQMMMMM FNHHDQHQQQ HQASSAYYTN LLSYPSFFDS FTWQPSSSVV  480
HGSGSGDISN NNANNAGGDH HQYYESEHAA SGGGGSGRDD DADVVQMASR EFLTPSPDEM  540
NLNLARGNAA GLTLSYGQEE EAGTAAEFVG LGSQQRGRAC MHGAG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-421882847103B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001132209.18e-95uncharacterized protein LOC100193638
TrEMBLB4FFS19e-95B4FFS1_MAIZE; Uncharacterized protein
STRINGSb01g013830.11e-92(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP188233101